PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10033735
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 339aa    MW: 37414.8 Da    PI: 6.7176
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10033735genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.22.4e-101648133
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgk 33
                     +g+WTteEd++l  +v+++G+g+W+  ++  gk
      Lus10033735 16 KGPWTTEEDDKLTSYVQLHGPGNWRNLPQNAGK 48
                     79************************9999884 PP

2Myb_DNA-binding231.9e-071091302547
                      HHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  25 ktIartmgkgRtlkqcksrwqky 47 
                      +tIa++++ gRt++++k++w+++
      Lus10033735 109 STIAARLP-GRTDNEIKNYWNTH 130
                      79******.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.03E-81145IPR009057Homeodomain-like
PROSITE profilePS512949.161165IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-101145IPR009057Homeodomain-like
SMARTSM007172.4E-815133IPR001005SANT/Myb domain
PfamPF002495.7E-81647IPR001005SANT/Myb domain
CDDcd001671.11E-518131No hitNo description
Gene3DG3DSA:1.10.10.604.2E-10109132IPR009057Homeodomain-like
SuperFamilySSF466891.2E-5109140IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MGRAPCCEKN NGSLKKGPWT TEEDDKLTSY VQLHGPGNWR NLPQNAGKNA LYLLVATSVF  60
IVKVFSRRIT RVHVPLQFEL LGEDDRGVLT STHVSPRFHP CVWALTPRST IAARLPGRTD  120
NEIKNYWNTH IRKKLLRNGI DPVTHAPRLD LLDFSTILGS LSYINPAVSL LSLLTAGQTH  180
QLSQPYLNPE LLRLAASALG SQIPTNVLAD QATSSQLQEN VYGFQELNNS NDTGRNSSSN  240
LQEDNLVSAP DEFGNWNTVP KLSDNCQSYF QSTTASEISN GGNVGNVGSS VMSTPLSSPG  300
RLANRVNWNS NTMTDHEYNN RLFKVEIPES LESFDDFM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-52MYB-like 102